Mouse Anti-Guinea pig ADI1 Antibody (MO-AB-41177W)


Cat: MO-AB-41177W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO41177W
SpecificityThis antibody binds to Guinea pig ADI1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Guinea pig ADI1 Antibody is a mouse antibody against ADI1. It can be used for ADI1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC 1.13.11.54) (Acireductone dioxygenase; Fe(2+)-requiring); Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1; ADI1; Adi1 Mtcbp1
UniProt IDH0VZQ2
Protein RefseqThe length of the protein is179 amino acids long.
The sequence is show below: MVQAWYMDESACDPRLPHRFEPDRPVSLKQLRALGVLYWKLDPDKYETDPELAQIRRDRNYSWMDIITICKDSLPNFEEKIRIFYTEHLHLDEEIRYILDGSGYFDVRDKTDKWIRICMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTAYNRPAEHFPARKQYMKFLEQTV.
For Research Use Only | Not For Clinical Use.
Online Inquiry