Mouse Anti-Cat ADI1 Antibody (MO-AB-08395W)


Cat: MO-AB-08395W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO08395W
SpecificityThis antibody binds to Cat ADI1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Cat ADI1 Antibody is a mouse antibody against ADI1. It can be used for ADI1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC 1.13.11.54) (Acireductone dioxygenase; Fe(2+)-requiring); Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1; ADI1; MTCBP1
UniProt IDM3WYI4
Protein RefseqThe length of the protein is 157 amino acids long.
The sequence is show below: MFPFINVTSFLLLFKLLQLDADRYENDPELEKIRKERNYSWMDIITICKDKLPDYEEKIKMFYKEHLHLDDEIRYILDGSGYFDVRDKEDKWVRIFMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTAYNRPADHFEVRGQYVEFLAQTE.
For Research Use Only | Not For Clinical Use.
Online Inquiry