Mouse Anti-Guinea pig ATP1B3 Antibody (MO-AB-41284W)
Cat: MO-AB-41284W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Guinea pig (Cavia porcellus) |
Clone | MO41284W |
Specificity | This antibody binds to Guinea pig ATP1B3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. |
Product Overview | Mouse Anti-Guinea pig ATP1B3 Antibody is a mouse antibody against ATP1B3. It can be used for ATP1B3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Sodium / potassium-transporting ATPase subunit beta-3; Sodium / potassium-dependent ATPase subunit beta-3; ATPB-3; CD antigen CD298; ATP1B3 |
UniProt ID | Q60489 |
Protein Refseq | The length of the protein is279 amino acids long. The sequence is show below: MTKSEKKSLNESLAQWKLFLYNPTTREFLGRTAKSWGLILLFYLVFYGFLAALFTFTMWAMLQTLNDEIPKYRDQIPSPGLMVFPKPVTALEYTFSVSDPSSYEGYIKDLKKFLKSYSLDEQKNLNKCTDGVLFEQTGPVYAACQFPDSLLEACSGTDDPDFGYSQGQPCVLVKMNRIIGLKPEGSPRIDCISKDENTAMVSTYPNQGVIDLKYFPYYGKKLHVGYLQPLVAVQVSFGSNSTKKEVTVECKIEGSKNLRNEDDRDKFLGRVAFKITARA. |
See other products for " ATP1B3 "
CBMOAB-36554FYA | Mouse Anti-Rhesus ATP1B3 Antibody (CBMOAB-36554FYA) |
MO-AB-25414W | Mouse Anti-Chimpanzee ATP1B3 Antibody (MO-AB-25414W) |
MO-AB-07289Y | Mouse Anti-Rabbit ATP1B3 Antibody (MO-AB-07289Y) |
MO-AB-51513W | Mouse Anti-Marmoset ATP1B3 Antibody (MO-AB-51513W) |
MO-AB-01706H | Mouse Anti-Frog atp1b3 Antibody (MO-AB-01706H) |
MO-AB-43760W | Mouse Anti-Horse ATP1B3 Antibody (MO-AB-43760W) |
MO-AB-07779R | Mouse Anti-Cattle ATP1B3 Antibody (MO-AB-07779R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry