Mouse Anti-Marmoset ATP1B3 Antibody (MO-AB-51513W)


Cat: MO-AB-51513W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO51513W
SpecificityThis antibody binds to Marmoset ATP1B3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Plasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2.
Product OverviewMouse Anti-Marmoset ATP1B3 Antibody is a mouse antibody against ATP1B3. It can be used for ATP1B3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSodium/potassium-transporting ATPase subunit beta-3; ATP1B3
UniProt IDU3B9M7
Protein RefseqThe length of the protein is 279 amino acids long.
The sequence is show below: MTKNEKKSLNQCLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSVSDPTSYAGYIADLKKFLKPYTLEEQKNLTTCPDGALFEQKGPVYVACQFPLLLLQACSGMSDPDFGYSKGKPCILVKMNRIIGLKPEGVPRIDCVLKNEDQTNITTYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVTLAPSSAEKEVTVECKIDGSPNLKSQDDRDKFLGRVMFKITAHA.
See other products for " ATP1B3 "
MO-AB-25414WMouse Anti-Chimpanzee ATP1B3 Antibody (MO-AB-25414W)
MO-AB-07289YMouse Anti-Rabbit ATP1B3 Antibody (MO-AB-07289Y)
MO-AB-07779RMouse Anti-Cattle ATP1B3 Antibody (MO-AB-07779R)
CBMOAB-36554FYAMouse Anti-Rhesus ATP1B3 Antibody (CBMOAB-36554FYA)
MO-AB-41284WMouse Anti-Guinea pig ATP1B3 Antibody (MO-AB-41284W)
MO-AB-01706HMouse Anti-Frog atp1b3 Antibody (MO-AB-01706H)
MO-AB-43760WMouse Anti-Horse ATP1B3 Antibody (MO-AB-43760W)
For Research Use Only | Not For Clinical Use.
Online Inquiry