Mouse Anti-Guinea pig CRP Antibody (MO-AB-41460W)


Cat: MO-AB-41460W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO41460W
SpecificityThis antibody binds to Guinea pig CRP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCRP (C-Reactive Protein) is a Protein Coding gene. Diseases associated with CRP include Acute Pancreatitis and Appendicitis. Among its related pathways are Creation of C4 and C2 activators and Overview of nanoparticle effects. Gene Ontology (GO) annotations related to this gene include calcium ion binding and cholesterol binding. An important paralog of this gene is APCS.
Product OverviewMouse Anti-Guinea pig CRP Antibody is a mouse antibody against CRP. It can be used for CRP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-reactive protein; CRP; PTX1
UniProt IDP49254
Protein RefseqThe length of the protein is225 amino acids long.
The sequence is show below: MAKLLLYFLLLTSLSDVFGGTDMSKKTFVFPKETDNSYVSLKAQLKKPLSAFTVCLHIYTELFMTRGYSIFSYATEKEANEILIFWSKDRGYILGVGGIEMPFKAPEIPSAPVHICTSWESVSGIIELWVDGKAQVRKSLQKGYFVGTEAMIILGQDQDSFGGSFDANQSFVGDIGDVNMWDFVLSPKEIDMVYSGGTFSPNVLSWRSLTYETHGEVFIKPQLWP.
See other products for " CRP "
MOFY-0722-FY306Rabbit Anti-CRP Antibody (MOFY-0722-FY306)
CBMOAB-14173FYAMouse Anti-D. melanogaster Crp Antibody (CBMOAB-14173FYA)
MO-AB-25101HMouse Anti-Rat CRP Antibody (MO-AB-25101H)
MOFY-0622-FY97Rabbit Anti-CRP Antibody (MOFY-0622-FY97)
MOFY-0622-FY141Rabbit Anti-CRP Antibody (MOFY-0622-FY141)
CBMOAB-71755FYAMouse Anti-Zebrafish crp Antibody (CBMOAB-71755FYA)
MO-AB-10750RMouse Anti-Cattle CRP Antibody (MO-AB-10750R)
MO-DKB-00289WRabbit Anti-crp Antibody (MO-DKB-00289W)
MO-AB-11079YMouse Anti-O. mykiss Crp Antibody (MO-AB-11079Y)
MOFY-0622-FY24Mouse Anti-CRP Antibody (MOFY-0622-FY24)
For Research Use Only | Not For Clinical Use.
Online Inquiry