Mouse Anti-Guinea pig FECH Antibody (MO-AB-41639W)


Cat: MO-AB-41639W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO41639W
SpecificityThis antibody binds to Guinea pig FECH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene. A pseudogene of this gene is found on chromosome 3.
Product OverviewMouse Anti-Guinea pig FECH Antibody is a mouse antibody against FECH. It can be used for FECH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFerrochelatase; EC 4.99.1.1; FECH
UniProt IDH0VN89
Protein RefseqThe length of the protein is424 amino acids long.
The sequence is show below: MLSAGTNMAAALRAAGGLLRGPLVHGSLKTHQPWRCQLGTAAAVTTSTETAQRTKSAKPQVQPEKRKPKTGILMLNMGGPETLGEVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKMWTSTQGEGMVKLLDDLSPDTAPHKYYIGFRYVHPLTEEAIEEMERDGLQRAIAFTQYPQYSCSTTGSSLNAIYRYYNEVGKKPTMKWSTIDRWPTHPLLIQCFADHILKELDHFPTEKRSEVVILFSAHSLPMSVVNRGDPYPQEVGATVQKVMEKLSYSNPYRLVWQSKVGPVPWLGPQTDEAIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGAENIRRAESLNGNPLFSKALADLVHSHIQSNKLCSKQLTLNCPLCVNPVCRETKSFFTNQQL.
See other products for " FECH "
MO-AB-30755WMouse Anti-Dog FECH Antibody (MO-AB-30755W)
CBMOAB-42793FYAMouse Anti-Rhesus FECH Antibody (CBMOAB-42793FYA)
MO-AB-03559HMouse Anti-Frog fech Antibody (MO-AB-03559H)
MO-AB-25808RMouse Anti-Pig FECH Antibody (MO-AB-25808R)
MO-AB-00447LMouse Anti-Elephant FECH Antibody (MO-AB-00447L)
MO-AB-06472YMouse Anti-O. anatinus FECH Antibody (MO-AB-06472Y)
MO-AB-22959WMouse Anti-Chimpanzee FECH Antibody (MO-AB-22959W)
MO-AB-33084HMouse Anti-Nile tilapia fech Antibody (MO-AB-33084H)
MO-AB-15235YMouse Anti-Sheep FECH Antibody (MO-AB-15235Y)
MO-AB-34741WMouse Anti-Ferret FECH Antibody (MO-AB-34741W)
For Research Use Only | Not For Clinical Use.
Online Inquiry