Mouse Anti-Guinea pig GRN Antibody (MO-AB-41771W)
Cat: MO-AB-41771W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Guinea pig (Cavia porcellus) |
Clone | MO41771W |
Specificity | This antibody binds to Guinea pig GRN. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Extracellular region or secreted; Lysosome; Other locations; Golgi apparatus; Endosome; Endoplasmic reticulum |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis. |
Product Overview | Mouse Anti-Guinea pig GRN Antibody is a mouse antibody against GRN. It can be used for GRN detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Granulins; Proepithelin; PEPI; [Cleaved into: Acrogranin (Progranulin); Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7]; GRN |
UniProt ID | P28797 |
Protein Refseq | The length of the protein is591 amino acids long. The sequence is show below: VAGIRCPDDQVCPVACCPDSGGASYSCCDPGVDLRTTALSGYLGRPCQSPANCPIGHSCVLTAAGTAACCPFSQAMACGDGHHCCPYGFHCSTDGGTCIQRPDIHLLGAVQCPGGEFECPDSSTCCHMLDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGSHPLTTKLPAQRTNYTGAEGTPVVSPGLLPAALPTSVICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCLSQNKAKTLLTKLPSWTVWDVECDQEVSCPEGQTCCRLQSGKWGCCPFPKAVCCEDHVHCCPERFRCHTEKDTCEQGLLQVPWAQKTPAQPSRPSQPSPPGPPGPPSPPGPLRSEISCDEVVSCRPGNICCRLASGEWGCCPSSEGYLCMAGERCQVGDRLAPEKMAAHLMSLSQTTDVGCDQHASCPVRQTCCPKLGGGWACCQLPHAVCCEDGQHCCPAGYTCNVKARSCEKAADGAHLAAPLAVGSTGGVMDVACGDRHFCHDEQTCCRDSRGGWACCPFHQGVCCKDQRHCCPAGFHCESQGTRCVHKKSLLHWDSLPRPAAPRPRL. |
See other products for " GRN "
CBMOAB-44155FYA | Mouse Anti-Rhesus GRN Antibody (CBMOAB-44155FYA) |
MO-AB-26637W | Mouse Anti-Chimpanzee GRN Antibody (MO-AB-26637W) |
MO-AB-26233R | Mouse Anti-Pig GRN Antibody (MO-AB-26233R) |
CBMOAB-18230FYA | Mouse Anti-D. melanogaster Grn Antibody (CBMOAB-18230FYA) |
MO-AB-04076H | Mouse Anti-Frog grn Antibody (MO-AB-04076H) |
MO-AB-56414W | Mouse Anti-Marmoset GRN Antibody (MO-AB-56414W) |
MO-AB-13370R | Mouse Anti-Cattle GRN Antibody (MO-AB-13370R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry