Mouse Anti-Marmoset GRN Antibody (MO-AB-56414W)


Cat: MO-AB-56414W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO56414W
SpecificityThis antibody binds to Marmoset GRN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Extracellular region or secreted; Lysosome; Plasma membrane; Other locations; Endoplasmic reticulum; Golgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGranulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis.
Product OverviewMouse Anti-Marmoset GRN Antibody is a mouse antibody against GRN. It can be used for GRN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGranulins; GRN
UniProt IDU3CZE1
Protein RefseqThe length of the protein is 592 amino acids long.
The sequence is show below: MWTLVSWVALTAGLVAGTWCPDGQFCPVACCLDPGGASYSCCSPLLDKWPTTLSRPLGGPCQVDAHCSAGHSCLLTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSAEGQSCFQRSGNNSMGAVQCPDSQFECPDSSTCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTPTGTHPLAKKIPAQRTNRAVALSSSVMCPDARSQCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQNTVCDLIQNKCLSKEHATDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPSGFTCDTQKGTCEQGTHQVPWMEKAPAHLSLLDPQALKRDVPCDNVTSCPPSNTCCQLMSGEWGCCSAPEAVCCSDHQHCCPQGYTCVVEGQCHRGPKIVAGLEKMPARRASGSHPRDIGCDQHTSCPVGQTCCPSLGGGWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARGPHVGMRDVECGAGHFCHDDQTCCRDSQGGWACCPYRQGVCCADQRHCCPAGFHCSAKGTKCLRRETLHWDTPLRDPALRQLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry