AibGenesis™ Mouse Anti-H2AC14 Antibody (MO-AB-23833W)


Cat: MO-AB-23833W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-23833W Monoclonal Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus) WB, ELISA MO23833W 100 µg
MO-AB-31059W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31059W 100 µg
MO-AB-44983W Monoclonal Horse (Equus caballus) WB, ELISA MO44983W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus)
CloneMO23833W
SpecificityThis antibody binds to Chimpanzee H2AC14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee H2AC14 Antibody is a mouse antibody against H2AC14. It can be used for H2AC14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2A; HIST1H2AJ
UniProt IDH2QSI6
Protein RefseqThe length of the protein is 128 amino acids long.
The sequence is show below: MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry