AibGenesis™ Mouse Anti-H2AC8 Antibody (MO-AB-23836W)


Cat: MO-AB-23836W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-23836W Monoclonal Chimpanzee (Pan troglodytes), Horse (Equus caballus) WB, ELISA MO23836W 100 µg
MO-AB-44985W Monoclonal Horse (Equus caballus) WB, ELISA MO44985W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Horse (Equus caballus)
CloneMO23836W
SpecificityThis antibody binds to Chimpanzee H2AC8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee H2AC8 Antibody is a mouse antibody against H2AC8. It can be used for H2AC8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2A; HIST1H2AB; HIST1H2AE
UniProt IDH2QSF5
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry