AibGenesis™ Mouse Anti-H2BU1 Antibody (MO-AB-21328W)


Cat: MO-AB-21328W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-21328W Monoclonal Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus) WB, ELISA MO21328W 100 µg
MO-AB-31070W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31070W 100 µg
MO-AB-44996W Monoclonal Horse (Equus caballus) WB, ELISA MO44996W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus)
CloneMO21328W
SpecificityThis antibody binds to Chimpanzee H2BU1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee H2BU1 Antibody is a mouse antibody against H2BU1. It can be used for H2BU1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2B; HIST2H2BF
UniProt IDH2RHF7
Protein RefseqThe length of the protein is 134 amino acids long.
The sequence is show below: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKLIGPILWK.
For Research Use Only | Not For Clinical Use.
Online Inquiry