Mouse Anti-Hamsters CDH2 Antibody (MO-AB-42989W)


Cat: MO-AB-42989W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHamsters (Cricetinae)
CloneMO42989W
SpecificityThis antibody binds to Hamsters CDH2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCDH2 (Cadherin 2) is a Protein Coding gene. Diseases associated with CDH2 include Arrhythmogenic Right Ventricular Cardiomyopathy and Malignant Pleural Mesothelioma. Among its related pathways are N-cadherin signaling events and PAK Pathway. Gene Ontology (GO) annotations related to this gene include calcium ion binding and protein phosphatase binding. An important paralog of this gene is CDH4.
Product OverviewMouse Anti-Hamsters CDH2 Antibody is a mouse antibody against CDH2. It can be used for CDH2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCadherin-2; Neural cadherin; N-cadherin; CD antigen CD325; CDH2
UniProt IDO55075
Protein RefseqThe length of the protein is238 amino acids long.
The sequence is show below: TKPLDRELIARFHLRAHAVDINGNRVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVEVIVANLTVTDKDQPHTPAWNAVYRISGGDPTGRFAIHTDPNSNDGLVTVVKPIDFETNRMFV.
For Research Use Only | Not For Clinical Use.
Online Inquiry