Mouse Anti-Sheep Cdh2 Antibody (MO-AB-14521Y)
Cat: MO-AB-14521Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Sheep (Ovis aries) |
| Clone | MO14521Y |
| Specificity | This antibody binds to Sheep Cdh2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Predicted to enable cadherin binding activity and calcium ion binding activity. Acts upstream of or within several processes, including animal organ development; embryonic morphogenesis; and nervous system development. Located in perinuclear region of cytoplasm and presynaptic membrane. Part of catenin complex. Is expressed in several structures, including germ ring; immature eye; mesoderm; nervous system; and pericardial region. |
| Product Overview | This product is a mouse antibody against Cdh2. It can be used for Cdh2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Neural-cadherin; Cdh2 |
| UniProt ID | Q30DR0 |
| Protein Refseq | The length of the protein is 74 amino acids long. The sequence is show below: QPDTVEPDAIKPVGIRRLDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGS. |
See other products for " CDH2 "
| MO-AB-09950R | Mouse Anti-Cattle CDH2 Antibody (MO-AB-09950R) |
| MO-AB-44015W | Mouse Anti-Horse CDH2 Antibody (MO-AB-44015W) |
| MO-AB-16338W | Mouse Anti-Chimpanzee CDH2 Antibody (MO-AB-16338W) |
| CBMOAB-69854FYA | Mouse Anti-Zebrafish cdh2 Antibody (CBMOAB-69854FYA) |
| MO-AB-52666W | Mouse Anti-Marmoset CDH2 Antibody (MO-AB-52666W) |
| MO-AB-07541Y | Mouse Anti-Rabbit CDH2 Antibody (MO-AB-07541Y) |
| MO-AB-42989W | Mouse Anti-Hamsters CDH2 Antibody (MO-AB-42989W) |
| MO-DKB-03593W | Rabbit Anti-CDH2 Antibody (Cat MO-DKB-03593W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry