Mouse Anti-Hamsters DPP4 Antibody (MO-AB-43089W)
Cat: MO-AB-43089W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Hamsters (Cricetinae) |
| Clone | MO43089W |
| Specificity | This antibody binds to Hamsters DPP4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. |
| Product Overview | Mouse Anti-Hamsters DPP4 Antibody is a mouse antibody against DPP4. It can be used for DPP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Dipeptidyl peptidase IV; DPP4 |
| UniProt ID | Q99J96 |
| Protein Refseq | The length of the protein is37 amino acids long. The sequence is show below: TVMSRAENFKQVQYLLIHGTADDNVHFQQSAQISKAL. |
See other products for " DPP4 "
| MO-AB-19559W | Mouse Anti-Chimpanzee DPP4 Antibody (MO-AB-19559W) |
| MO-AB-07731W | Mouse Anti-Cat DPP4 Antibody (MO-AB-07731W) |
| MO-AB-14987Y | Mouse Anti-Sheep DPP4 Antibody (MO-AB-14987Y) |
| CBMOAB-00066FYA | Mouse Anti-Cattle DPP4 Antibody (CBMOAB-00066FYA) |
| MO-AB-34691W | Mouse Anti-Ferret DPP4 Antibody (MO-AB-34691W) |
| CBMOAB-00067FYA | Mouse Anti-Cattle DPP4 Antibody (CBMOAB-00067FYA) |
| CBMOAB-00064FYA | Mouse Anti-Cattle DPP4 Antibody (CBMOAB-00064FYA) |
| MO-AB-25444R | Mouse Anti-Pig DPP4 Antibody (MO-AB-25444R) |
| CBMOAB-00065FYA | Mouse Anti-Cattle DPP4 Antibody (CBMOAB-00065FYA) |
| MO-AB-03091H | Mouse Anti-Frog dpp4 Antibody (MO-AB-03091H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry