Cat: MO-AB-25444R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO25444R |
Specificity | This antibody binds to Pig DPP4. |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | This product is a mouse antibody against DPP4. It can be used for DPP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Dipeptidyl peptidase 4; DPP4 |
UniProt ID | K7GMK0 |
Protein Refseq | The length of the protein is 55 amino acids long. The sequence is show below: MNISTNKKIISCYSMLNMETAPFSWRTVHLMNLDILQMITRYLLIDNLFSSNTTM. |
See other products for " dpp4 "
MO-AB-03091H | Mouse Anti-Frog dpp4 Antibody (MO-AB-03091H) |
CBMOAB-00067FYA | Mouse Anti-Cattle DPP4 Antibody (CBMOAB-00067FYA) |
MO-AB-07731W | Mouse Anti-Cat DPP4 Antibody (MO-AB-07731W) |
MO-AB-14988Y | Mouse Anti-Sheep DPP4 Antibody (MO-AB-14988Y) |
MO-AB-37145W | Mouse Anti-Goat DPP4 Antibody (MO-AB-37145W) |
CBMOAB-41149FYA | Mouse Anti-Rhesus DPP4 Antibody (CBMOAB-41149FYA) |
MO-AB-03093H | Mouse Anti-Frog dpp4 Antibody (MO-AB-03093H) |
MO-AB-34691W | Mouse Anti-Ferret DPP4 Antibody (MO-AB-34691W) |
CBMOAB-00066FYA | Mouse Anti-Cattle DPP4 Antibody (CBMOAB-00066FYA) |
MO-AB-03092H | Mouse Anti-Frog dpp4 Antibody (MO-AB-03092H) |
For Research Use Only | Not For Clinical Use.