Mouse Anti-Pig DPP4 Antibody (MO-AB-25444R)
Cat: MO-AB-25444R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO25444R |
Specificity | This antibody binds to Pig DPP4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. |
Product Overview | This product is a mouse antibody against DPP4. It can be used for DPP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Dipeptidyl peptidase 4; DPP4 |
UniProt ID | K7GMK0 |
Protein Refseq | The length of the protein is 55 amino acids long. The sequence is show below: MNISTNKKIISCYSMLNMETAPFSWRTVHLMNLDILQMITRYLLIDNLFSSNTTM. |
See other products for " DPP4 "
MO-AB-37145W | Mouse Anti-Goat DPP4 Antibody (MO-AB-37145W) |
MO-AB-54471W | Mouse Anti-Marmoset DPP4 Antibody (MO-AB-54471W) |
MO-AB-19559W | Mouse Anti-Chimpanzee DPP4 Antibody (MO-AB-19559W) |
MO-AB-11636R | Mouse Anti-Cattle DPP4 Antibody (MO-AB-11636R) |
CBMOAB-00064FYA | Mouse Anti-Cattle DPP4 Antibody (CBMOAB-00064FYA) |
CBMOAB-00066FYA | Mouse Anti-Cattle DPP4 Antibody (CBMOAB-00066FYA) |
CBMOAB-00067FYA | Mouse Anti-Cattle DPP4 Antibody (CBMOAB-00067FYA) |
MO-AB-07731W | Mouse Anti-Cat DPP4 Antibody (MO-AB-07731W) |
CBMOAB-41150FYA | Mouse Anti-Rhesus DPP4 Antibody (CBMOAB-41150FYA) |
MO-AB-14987Y | Mouse Anti-Sheep DPP4 Antibody (MO-AB-14987Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry