Mouse Anti-Hamsters FAU Antibody (MO-AB-43139W)
Cat: MO-AB-43139W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Hamsters (Cricetinae) |
Clone | MO43139W |
Specificity | This antibody binds to Hamsters FAU. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome and displays antimicrobial activity. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. |
Product Overview | Mouse Anti-Hamsters FAU Antibody is a mouse antibody against FAU. It can be used for FAU detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ubiquitin-like protein FUBI; Arsenite-resistance protein; FAU; ASR1 |
UniProt ID | Q60435 |
Protein Refseq | The length of the protein is74 amino acids long. The sequence is show below: MQLFVRAQGLHTLEVTGQETVAQIKAHVASLEGISPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGG. |
See other products for " Fau "
MO-AB-25780H | Mouse Anti-Rat Fau Antibody (MO-AB-25780H) |
MO-AB-03499H | Mouse Anti-Frog fau Antibody (MO-AB-03499H) |
MO-AB-12386R | Mouse Anti-Cattle FAU Antibody (MO-AB-12386R) |
CBMOAB-16564FYA | Mouse Anti-D. melanogaster Fau Antibody (CBMOAB-16564FYA) |
MO-AB-00474R | Mouse Anti-Medaka fau Antibody (MO-AB-00474R) |
MO-AB-22181W | Mouse Anti-Chimpanzee FAU Antibody (MO-AB-22181W) |
CBMOAB-42616FYA | Mouse Anti-Rhesus FAU Antibody (CBMOAB-42616FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry