Mouse Anti-Medaka fau Antibody (MO-AB-00474R)


Cat: MO-AB-00474R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO00474R
SpecificityThis antibody binds to Medaka fau.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome and displays antimicrobial activity. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin.
Product OverviewThis product is a mouse antibody against fau. It can be used for fau detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names40S ribosomal protein S30; rps30
UniProt IDH2MJQ4
Protein RefseqThe length of the protein is 133 amino acids long.
The sequence is show below: MQLFLRAQNTHTLEVTGEETVGQIKAHVQTLEGILVEDQVLMLTGCPLEDDASLVSCGVSEFCTLEVAGRLLGGKVHGSLARAGKVRGQTPKVDKQEKKKKKTGRAKRRIQYNRRFVNVVPTFGKKKGPNANS.
For Research Use Only | Not For Clinical Use.
Online Inquiry