Rabbit Anti-hb Antibody (MO-DKB-00547W)


Cat: MO-DKB-00547W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-DKB-00547W Polyclonal Fruit fly (Drosophila melanogaster), Bovine, Dog, Human, Goat, Guinea pig, Pig, Rabbit, Rhesus WB 100 µg
Inquiry
MOFY-0622-FY136 Polyclonal Guinea pig WB, IHC, ICC 100 µg
Inquiry
MOFY-0622-FY137 Polyclonal Guinea pig WB, IHC, ICC, IP 100 µg
Inquiry
MOFY-0622-FY171 Polyclonal Rabbit WB, IHC, ICC, IP 100 µg
Inquiry
MOFY-0722-FY101 Polyclonal Rhesus WB, IHC, ICC 100 µg
Inquiry
MOFY-0722-FY174 Polyclonal Dog, Human WB, IHC, ICC, IP 100 µg
Inquiry
MOFY-0722-FY231 Polyclonal Pig, Human, Pig WB, IHC, ICC, IP 100 µg
Inquiry
MOFY-0722-FY295 Polyclonal Bovine WB, IHC, ICC, IP 100 µg
Inquiry
MOFY-0722-FY421 Polyclonal Goat WB, IHC, ICC, IP 100 µg
Inquiry
MOFY-0722-FY432 Polyclonal Rhesus, Human, Dog, Pig WB, IHC, ICC, IP 100 µg
Inquiry

Specifications

Host speciesRabbit (Oryctolagus cuniculus)
Species ReactivityFruit fly (Drosophila melanogaster), Bovine, Dog, Human, Goat, Guinea pig, Pig, Rabbit, Rhesus
ImmunogenA synthetic peptide corresponding to the middle region of the Drosophila protein kyphosis. Peptide sequence MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP
EpitopeThe epitope is in the Center of hb.
FormatLiquid or Lyophilized
BufferPBS, 2% sucrose
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
PurityAffinity purified

Application Information

ApplicationWB
Application NotesWestern Blot 1.0 ug/ml

Target

Product OverviewThis product is a Rabbit antibody against the Center of the hb. It can be used for hb detection in Western Blot.
Alternative Nameshb; hunchback
UniProt IDP05084
For Research Use Only | Not For Clinical Use.
Online Inquiry