AibGenesis™ Mouse Anti-HBM Antibody (CBMOAB-44386FYA)


Cat: CBMOAB-44386FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44386FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO44386FYA 100 µg
MO-AB-13557R Monoclonal Cattle (Bos taurus) WB, ELISA MO13557R 100 µg
MO-AB-56597W Monoclonal Marmoset WB, ELISA MO56597W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO44386FYA
SpecificityThis antibody binds to Rhesus HBM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. This gene has an ORF encoding a 141 aa polypeptide which is similar to the delta globins found in reptiles and birds. This locus was originally described as a pseudogene; however, it is currently thought to be a protein-coding gene. (From NCBI)
Product OverviewMouse Anti-Rhesus HBM Antibody is a mouse antibody against HBM. It can be used for HBM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHBM
UniProt IDF6ZP35
Protein RefseqThe length of the protein is 141 amino acids long.
The sequence is show below: MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSSCQDATQLLSHGQRMLAAVGAAVQHMDHLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVEMQAAWDKFLTGVAVVLTEKYR.
For Research Use Only | Not For Clinical Use.
Online Inquiry