AibGenesis™ Mouse Anti-hdhd1 Antibody (CBMOAB-79223FYA)


Cat: CBMOAB-79223FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-79223FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes) WB, ELISA MO79223FYA 100 µg
MO-AB-10913W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10913W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes)
CloneMO79223FYA
SpecificityThis antibody binds to Zebrafish hdhd1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish hdhd1 Antibody is a mouse antibody against hdhd1. It can be used for hdhd1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Nameshdhd1
UniProt IDF1RE99
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: MSYKPVTHVLFDMDGLLLDTERLYTVSFQEVCDRFNKQYTWEVKSSVMGKKALDAARIIRDKIGLPMTPEELLEETRKIQERLFPTTSLLPGVEKLVNHLHKHGIPIAVGTSSAGLTFEMKTSRHKEFFSLFSHIVLGDDPDVKNGKPLPDTFLVCAKRFSPPANPKQCLVFEDAPNGVKAGLAAGMQVVMIPDDNLDRSLTQEATLLLRSMEDFRPELFGLPAYA.
For Research Use Only | Not For Clinical Use.
Online Inquiry