AibGenesis™ Mouse Anti-HES4 Antibody (CBMOAB-44494FYA)


Cat: CBMOAB-44494FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44494FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Sea-anemone WB, ELISA MO44494FYA 100 µg
CBMOAB-60228FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60228FYC 100 µg
MO-AB-13876Y Monoclonal Sea-anemone WB, ELISA MO13876Y 100 µg
MO-AB-56691W Monoclonal Marmoset WB, ELISA MO56691W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Sea-anemone
CloneMO44494FYA
SpecificityThis antibody binds to Rhesus HES4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HES4 Antibody is a mouse antibody against HES4. It can be used for HES4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHES4
UniProt IDF7GS86
Protein RefseqThe length of the protein is 221 amino acids long.
The sequence is show below: MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALNADPAVLGKYRAGFHECLAEVNRFLADCEGVPADVRSRLLGHLAACLRQLGPSRRPASLPPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTGALPVAPRAGLQGQGGPWRPWLR.
For Research Use Only | Not For Clinical Use.
Online Inquiry