Mouse Anti-hist1h2ad Antibody (MO-AB-04253H)


Cat: MO-AB-04253H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04253H Monoclonal Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus) WB, ELISA MO04253C 100 µg
Inquiry
MO-AB-08357Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08357Y 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Rabbit (Oryctolagus cuniculus)
CloneMO04253C
SpecificityThis antibody binds to Frog hist1h2ad.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. (From NCBI)
Product OverviewThis product is a mouse antibody against hist1h2ad. It can be used for hist1h2ad detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2A; hist1h2ad; MGC82198
UniProt IDQ6AZS1
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKPAKSK.
See other products for " HIST1H2AD "
MO-AB-23835WMouse Anti-HIST1H2AD Antibody (MO-AB-23835W)
For Research Use Only | Not For Clinical Use.
Online Inquiry