AibGenesis™ Mouse Anti-Hist1h2bo Antibody (MO-AB-26304H)


Cat: MO-AB-26304H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-26304H Monoclonal Rat (Rattus norvegicus), Marmoset WB, ELISA MO26304C 100 µg
MO-AB-56772W Monoclonal Marmoset WB, ELISA MO56772W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Marmoset
CloneMO26304C
SpecificityThis antibody binds to Rat Hist1h2bo.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the small histone gene cluster on chromosome 6p22-p21.3. (From NCBI)
Product OverviewThis product is a mouse antibody against Hist1h2bo. It can be used for Hist1h2bo detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2B; Hist1h2bo
UniProt IDD3ZNH4
Protein RefseqThe length of the protein is 138 amino acids long.
The sequence is show below: MPDPVKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKILWNKFYYLPSF.
For Research Use Only | Not For Clinical Use.
Online Inquiry