AibGenesis™ Mouse Anti-HIST2H2AA4 Antibody (CBMOAB-44579FYA)


Cat: CBMOAB-44579FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44579FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO44579FYA 100 µg
MO-AB-08359Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08359Y 100 µg
MO-AB-23842W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23842W 100 µg
MO-AB-56777W Monoclonal Marmoset WB, ELISA MO56777W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO44579FYA
SpecificityThis antibody binds to Rhesus HIST2H2AA4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the telomeric copy. (From NCBI)
Product OverviewMouse Anti-Rhesus HIST2H2AA4 Antibody is a mouse antibody against HIST2H2AA4. It can be used for HIST2H2AA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2A; HIST2H2AA4
UniProt IDI0FGF5
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry