AibGenesis™ Mouse Anti-hist2h2l Antibody (CBMOAB-79506FYA)


Cat: CBMOAB-79506FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-79506FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79506FYA 100 µg
Inquiry
MO-DKB-00153W Polyclonal Zebrafish (Danio rerio) ELISA, WB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO79506FYA
SpecificityThis antibody binds to Zebrafish hist2h2l.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCore component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish hist2h2l Antibody is a mouse antibody against hist2h2l. It can be used for hist2h2l detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2B 3; hist2h2
UniProt IDQ6PC60
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: MPEPAKSAPAPKKGSKKAVTKTQKKGDKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry