AibGenesis™ Mouse Anti-HNRPC Antibody (CBMOAB-79750FYA)


Cat: CBMOAB-79750FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-79750FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus) WB, ELISA MO79750FYA 100 µg
MO-AB-13739R Monoclonal Cattle (Bos taurus) WB, ELISA MO13739R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus)
CloneMO79750FYA
SpecificityThis antibody binds to Zebrafish HNRPC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish HNRPC Antibody is a mouse antibody against HNRPC. It can be used for HNRPC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHeterogeneous nuclear ribonucleoprotein; HNRP
UniProt IDQ6TGZ6
Protein RefseqThe length of the protein is 279 amino acids long.
The sequence is show below: MASNVTNKTDPRSLNSRVFIGNLNTMLVTKADVEAIFSKYGKIVGCSVHKGFAFVQYANERNARAAVNGEDGRMIVGQVLDINLAGEPKPHRSKTIKRSAGDMYSSSFDLDYDFQRDYYDRMYSYPSRVPPPPPPLSRAVIPSKRARVSVSGSRRTKSSFSSKSSQRTSRTMRADDLQTIKKELTQIKHKVDYLLESLERMERDHSKKSDVKSAKAEEVSPQHGKKDRENSEMNDYEDEGDLLEEEEIKSRGREDDEEEEEGEQEEGEDDGDSANGDHA.
For Research Use Only | Not For Clinical Use.
Online Inquiry