AibGenesis™ Mouse Anti-HNRPM Antibody (MO-AB-02314Y)


Cat: MO-AB-02314Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-02314Y Monoclonal Chicken (Gallus gallus), Cattle (Bos taurus) WB, ELISA MO02314Y 100 µg
Inquiry
MO-AB-13743R Monoclonal Cattle (Bos taurus) WB, ELISA MO13743R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChicken (Gallus gallus), Cattle (Bos taurus)
CloneMO02314Y
SpecificityThis antibody binds to Chicken HNRPM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against HNRPM. It can be used for HNRPM detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesHeterogeneous nuclear ribonucleoprotein M; HNRPM
UniProt IDQ6QT57
Protein RefseqThe length of the protein is 40 amino acids long. The sequence is show below: GEVTYVELLMDAERKSRGCAVVEFKMEESMKKAAEVLNKH.
For Research Use Only | Not For Clinical Use.
Online Inquiry