AibGenesis™ Mouse Anti-HORMAD2 Antibody (CBMOAB-44740FYA)


Cat: CBMOAB-44740FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44740FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Rat (Rattus norvegicus) WB, ELISA MO44740FYA 100 µg
MO-AB-13754R Monoclonal Cattle (Bos taurus) WB, ELISA MO13754R 100 µg
MO-AB-26337H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26337C 100 µg
MO-AB-31141W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31141W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Rat (Rattus norvegicus)
CloneMO44740FYA
SpecificityThis antibody binds to Rhesus HORMAD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HORMAD2 Antibody is a mouse antibody against HORMAD2. It can be used for HORMAD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHORMAD2
UniProt IDF6RD07
Protein RefseqThe length of the protein is 275 amino acids long.
The sequence is show below: MATAQLSHSITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHIIRWIQGCFDALEKRYVRILKYMSLYTNPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGTNNEDIKKAGVLLIRKLYILMQDLEPLPNNVVLTMKLHYYNAVTPHDYQPLGFKEEVNSHFLLFDKEPINVQVGFVSTGFHSMKVKVMTEATKVTDLENNLFRENSTTELAHQGLDCDEEEECNDHV.
For Research Use Only | Not For Clinical Use.
Online Inquiry