Mouse Anti-Horse ADORA3 Antibody (MO-AB-43590W)


Cat: MO-AB-43590W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO43590W
SpecificityThis antibody binds to Horse ADORA3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Alternative splicing results in multiple transcript variants. This gene shares its 5' terminal exon with some transcripts from overlapping GeneID:57413, which encodes an immunoglobulin domain-containing protein.
Product OverviewMouse Anti-Horse ADORA3 Antibody is a mouse antibody against ADORA3. It can be used for ADORA3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenosine A3 receptor; ADORA3
UniProt IDQ9BG13
Protein RefseqThe length of the protein is107 amino acids long.
The sequence is show below: CQFRSVVSMDYMVYFSFFTWIFIPLAVMSAIYLDIFFVIRNKLSQNSSGSKETGAFYGREFKTAKSLFLVLFLFALSWLPLSIINCITYFNGEVPQTVLYLGILLSH.
For Research Use Only | Not For Clinical Use.
Online Inquiry