Mouse Anti-Horse CD9 Antibody (MO-AB-44009W)


Cat: MO-AB-44009W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO44009W
SpecificityThis antibody binds to Horse CD9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD9 (CD9 Molecule) is a Protein Coding gene. Diseases associated with CD9 include Cytomegalovirus Retinitis and Diphtheria. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Uptake and actions of bacterial toxins. Gene Ontology (GO) annotations related to this gene include integrin binding. An important paralog of this gene is TSPAN2.
Product OverviewMouse Anti-Horse CD9 Antibody is a mouse antibody against CD9. It can be used for CD9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTetraspanin; CD9
UniProt IDF6WQJ4
Protein RefseqThe length of the protein is204 amino acids long.
The sequence is show below: LAGIAVLAIGLWLRFDSQTKSIFEQENNNSSFYTGVYILIGAGALIMVVGFLGCCGAVQESQCMLGLFFCFLLVIFAIEIAAAIWGYSHKDEVIKDIQEFYKDTYNKLKTKDEPQRETLKAIHYALDCCGIVGGVEQFISDICPQKDVLSSFTTKPCPEAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV.
For Research Use Only | Not For Clinical Use.
Online Inquiry