Mouse Anti-Horse CLPS Antibody (MO-AB-44087W)


Cat: MO-AB-44087W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO44087W
SpecificityThis antibody binds to Horse CLPS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a cofactor needed by pancreatic lipase for efficient dietary lipid hydrolysis. It binds to the C-terminal, non-catalytic domain of lipase, thereby stabilizing an active conformation and considerably increasing the overall hydrophobic binding site. The gene product allows lipase to anchor noncovalently to the surface of lipid micelles, counteracting the destabilizing influence of intestinal bile salts. This cofactor is only expressed in pancreatic acinar cells, suggesting regulation of expression by tissue-specific elements. Three transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Horse CLPS Antibody is a mouse antibody against CLPS. It can be used for CLPS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesColipase protein; CLPS
UniProt IDQ9TV92
Protein RefseqThe length of the protein is43 amino acids long.
The sequence is show below: ENSECSAWTLYGVYYKCPCERGLTCQVDKTLVGSIMNTNFGIC.
For Research Use Only | Not For Clinical Use.
Online Inquiry