Mouse Anti-Horse CLU Antibody (MO-AB-44090W)


Cat: MO-AB-44090W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO44090W
SpecificityThis antibody binds to Horse CLU.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Cytosol; Cytoskeleton; Other locations; Mitochondrion; Nucleus; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.
Product OverviewMouse Anti-Horse CLU Antibody is a mouse antibody against CLU. It can be used for CLU detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesClusterin; [Cleaved into: Clusterin beta chain; Clusterin alpha chain]; CLU
UniProt IDQ29482
Protein RefseqThe length of the protein is449 amino acids long.
The sequence is show below: MKTLLLLVGLLLTLENGQVLGDKAVSDRELQEMSTQGSNYINKEIKNALKGVKQIKNLIEQTNEERKSLLGTLEEAKKKKEGALNDTKDSEMKLKESQGVCNETMTALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWINGDRIDSLLENDRQQTHVLDVMQDSFDRASSIMDELFQDRFFTREPQDTYYYSPFSSPHRRSSLLFNPKSRFARNIMHFPMYRHLNFNDMFQPFFDMIHQAQQAMNLHLHRLPDQLPMTEFSEGDNHDRTVCKEIRHNSTGCLKMKDQCEKCQEILSVDCSTNNPSQMQLRQELNNSLQLAEKFTKLYDELLQSYQEKMLNTSSLLKQLNEQFSWVSQLANLTQGEDQYYLQVTTVSSHNSDSEVPSGLTRVVVKLFDSYPITVTVPEVVSRNNPKFMETVAEKALQEYRQKNREE.
For Research Use Only | Not For Clinical Use.
Online Inquiry