Mouse Anti-Horse COL1A1 Antibody (MO-AB-44115W)
Cat: MO-AB-44115W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Horse (Equus caballus) |
| Clone | MO44115W |
| Specificity | This antibody binds to Horse COL1A1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | COL1A1 (Collagen Type I Alpha 1 Chain) is a Protein Coding gene. Diseases associated with COL1A1 include Caffey Disease and Osteogenesis Imperfecta, Type I. Among its related pathways are Integrin Pathway and ERK Signaling. Gene Ontology (GO) annotations related to this gene include identical protein binding and platelet-derived growth factor binding. An important paralog of this gene is COL2A1. |
| Product Overview | Mouse Anti-Horse COL1A1 Antibody is a mouse antibody against COL1A1. It can be used for COL1A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Collagen alpha-1(I; COL1A1 |
| UniProt ID | A0A060D0Y2 |
| Protein Refseq | The length of the protein is87 amino acids long. The sequence is show below: QEEGQEEGQEEDIPAVTCIQDGLRYHDRAVWKPEPCRVCICDNGNVLCDDVICEDTKNCPGASVPKDECCPVCPEGQVSPTDDQTTG. |
See other products for " COL1A1 "
| MOFY-0522-FY83 | Mouse Anti-COL1A1 Antibody (MOFY-0522-FY83) |
| MO-AB-02547H | Mouse Anti-Frog col1a1 Antibody (MO-AB-02547H) |
| MO-AB-24958H | Mouse Anti-Rat Col1a1 Antibody (MO-AB-24958H) |
| MO-AB-34181W | Mouse Anti-Donkey COL1A1 Antibody (MO-AB-34181W) |
| MO-AB-24735R | Mouse Anti-Pig COL1A1 Antibody (MO-AB-24735R) |
| MO-AB-17284W | Mouse Anti-Chimpanzee COL1A1 Antibody (MO-AB-17284W) |
| MO-AB-29652W | Mouse Anti-Dog COL1A1 Antibody (MO-AB-29652W) |
| MO-AB-32970H | Mouse Anti-Nile tilapia COL1A1 Antibody (MO-AB-32970H) |
| MO-AB-10507R | Mouse Anti-Cattle COL1A1 Antibody (MO-AB-10507R) |
| MOFAB-781W | Mouse Anti-COL1A1 Antibody (MOFAB-781W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry