Mouse Anti-Horse ENO2 Antibody (MO-AB-44594W)


Cat: MO-AB-44594W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO44594W
SpecificityThis antibody binds to Horse ENO2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.
Product OverviewMouse Anti-Horse ENO2 Antibody is a mouse antibody against ENO2. It can be used for ENO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEnolase 2; ENO2
UniProt IDI3RM61
Protein RefseqThe length of the protein is424 amino acids long.
The sequence is show below: MSIEKIWAREILDSRGNPTVEVDLCTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINTTIAPALISSGFSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEAXETGEGSHRQGWLPEKIVIGMDVAASEFYRDGKYDLDFKSPADPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFA.
See other products for " ENO2 "
CBMOAB-28434FYCMouse Anti-Arabidopsis ENO2 Antibody (CBMOAB-28434FYC)
CBMOAB-01200CRMouse Anti-Yeast ENO2 Antibody (CBMOAB-01200CR)
MO-NAB-00418WRabbit Anti-ENO2 Antibody (AA 30-70)
MO-DKB-00356WRabbit Anti-ENO2 Antibody (MO-DKB-00356W)
MO-AB-54947WMouse Anti-Marmoset ENO2 Antibody (MO-AB-54947W)
MO-AB-34725WMouse Anti-Ferret ENO2 Antibody (MO-AB-34725W)
MO-AB-12029RMouse Anti-Cattle ENO2 Antibody (MO-AB-12029R)
MO-AB-01755YMouse Anti-Chicken ENO2 Antibody (MO-AB-01755Y)
MO-DKB-01195WRabbit Anti-ENO2 Antibody (MO-DKB-01195W)
MO-DKB-0193RARabbit Anti-ENO2 Antibody (MO-DKB-0193RA)
For Research Use Only | Not For Clinical Use.
Online Inquiry