Mouse Anti-Horse GGT1 Antibody (MO-AB-44855W)


Cat: MO-AB-44855W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO44855W
SpecificityThis antibody binds to Horse GGT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe enzyme encoded by this gene is a type I gamma-glutamyltransferase that catalyzes the transfer of the glutamyl moiety of glutathione to a variety of amino acids and dipeptide acceptors. The enzyme is composed of a heavy chain and a light chain, which are derived from a single precursor protein. It is expressed in tissues involved in absorption and secretion and may contribute to the etiology of diabetes and other metabolic disorders. Multiple alternatively spliced variants have been identified. There are a number of related genes present on chromosomes 20 and 22, and putative pseudogenes for this gene on chromosomes 2, 13, and 22.
Product OverviewMouse Anti-Horse GGT1 Antibody is a mouse antibody against GGT1. It can be used for GGT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGamma-glutamyltransferase 1; GGT1
UniProt IDE5G727
Protein RefseqThe length of the protein is96 amino acids long.
The sequence is show below: TSYYEPEFYTPDGGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSLVSGILFNDEMDDFSSPNITNEFGVPPSPANFIKPGKQPLSSMCPAIIVGR.
For Research Use Only | Not For Clinical Use.
Online Inquiry