Mouse Anti-Yeast GGT1 Antibody (MO-NAB-00244W)
Cat: MO-NAB-00244W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Human (Homo sapiens), Mouse (Mus musculus), Yeast |
| Clone | 1F9 |
| Immunogen | GGT1 (NP_005256, 381 a.a.~470 a.a) partial recombinant protein with GST tag. The MW of only the GST tag is 26 KDa. TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG. |
| Format | Liquid or Lyophilized |
| Buffer | PBS, pH 7.4 |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | IgG purified |
Application Information
| Application | WB, ELISA, IF, IHC, IHC-P, IP, S-ELISA |
| Application Notes | WB: 1/500 IHC: 1/10-1/500 IHC-P: 1/10-1/500 IP: 1/10-1/500 Sandwich ELISA: 1/100-1/2000 |
Target
| Introduction | The enzyme encoded by this gene is a type I gamma-glutamyltransferase that catalyzes the transfer of the glutamyl moiety of glutathione to a variety of amino acids and dipeptide acceptors. The enzyme is composed of a heavy chain and a light chain, which are derived from a single precursor protein. It is expressed in tissues involved in absorption and secretion and may contribute to the etiology of diabetes and other metabolic disorders. Multiple alternatively spliced variants have been identified. There are a number of related genes present on chromosomes 20 and 22, and putative pseudogenes for this gene on chromosomes 2, 13, and 22. [provided by RefSeq, Jan 2014] |
| Product Overview | Mouse Anti-Yeast GGT1 (clone 1F9) Antibody (MO-NAB-00244W) is a Mouse antibody against the epitope of the GGT1. It can be used for GGT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay, Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunoprecipitation, S-Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Gamma-Glutamyltransferase 1; Gamma-Glutamyltranspeptidase 1; Leukotriene-C4 Hydrolase; EC 2.3.2.2; GGT 1; GGT; Glutathione Hydrolase 1 Proenzyme; Testicular Tissue Protein Li 73; Glutathione Hydrolase 1 |
| Gene ID | 2678 |
| UniProt ID | P19440 |
See other products for " ggt1 "
| MO-AB-03890H | Mouse Anti-Frog ggt1 Antibody (MO-AB-03890H) |
| MO-AB-55980W | Mouse Anti-Marmoset GGT1 Antibody (MO-AB-55980W) |
| MO-AB-44855W | Mouse Anti-Horse GGT1 Antibody (MO-AB-44855W) |
| CBMOAB-43565FYA | Mouse Anti-Rhesus GGT1 Antibody (CBMOAB-43565FYA) |
| MO-AB-26068R | Mouse Anti-Pig GGT1 Antibody (MO-AB-26068R) |
| MO-AB-00525H | Mouse Anti-Arabidopsis GGT1 Antibody (MO-AB-00525H) |
| CBMOAB-33983FYC | Mouse Anti-Arabidopsis GGT1 Antibody (CBMOAB-33983FYC) |
| MO-AB-19182W | Mouse Anti-Chimpanzee GGT1 Antibody (MO-AB-19182W) |
| MO-AB-03731W | Mouse Anti-Rhesus GGT1 Antibody (MO-AB-03731W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry