Mouse Anti-Horse RAF1 Antibody (MO-AB-46296W)


Cat: MO-AB-46296W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO46296W
SpecificityThis antibody binds to Horse RAF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to activate the serine/threonine specific protein kinases, ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Mutations in this gene are associated with Noonan syndrome 5 and LEOPARD syndrome 2.
Product OverviewMouse Anti-Horse RAF1 Antibody is a mouse antibody against RAF1. It can be used for RAF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibonuclease A F1; RAF1
UniProt IDW0UVI7
Protein RefseqThe length of the protein is159 amino acids long.
The sequence is show below: MVPTQRDSRLCLLLLLGILGMVISYHATPAGLTRTQWFEIQHIKNMTHRRCNNEMLRVNNYTKRCKNINTFLHTTFAFVASVCNTPNVTCPTTRYMNCHNSSVQVDITDCNLTSAPQPYKNCNYRQTSARKYFIVACNNSQPGDNATYSVVPVHLDWIS.
For Research Use Only | Not For Clinical Use.
Online Inquiry