Mouse Anti-Horse VEGFA Antibody (MO-AB-47060W)
Cat: MO-AB-47060W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO47060W |
Specificity | This antibody binds to Horse VEGFA. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome. Allelic variants of this gene have been associated with microvascular complications of diabetes 1 (MVCD1) and atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been described. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. |
Product Overview | Mouse Anti-Horse VEGFA Antibody is a mouse antibody against VEGFA. It can be used for VEGFA detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Vascular endothelial growth factor A; VEGFA |
UniProt ID | F6XLT6 |
Protein Refseq | The length of the protein is214 amino acids long. The sequence is show below: MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQEKKSVRGKGKGQKRKRKKSRYKLWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR. |
See other products for " VEGFA "
MO-AB-18211Y | Mouse Anti-Sheep VEGFA Antibody (MO-AB-18211Y) |
MO-AB-09029H | Mouse Anti-Frog vegfa Antibody (MO-AB-09029H) |
MO-AB-08790W | Mouse Anti-Cat VEGFA Antibody (MO-AB-08790W) |
MOFY-0622-FY202 | Rabbit Anti-VEGFA Antibody (MOFY-0622-FY202) |
MOFY-0622-FY186 | Guinea pig Anti-VEGFA Antibody (MOFY-0622-FY186) |
MO-AB-29970H | Mouse Anti-Rat Vegfa Antibody (MO-AB-29970H) |
MO-AB-34012W | Mouse Anti-Dog VEGFA Antibody (MO-AB-34012W) |
MO-AB-22770R | Mouse Anti-Cattle VEGFA Antibody (MO-AB-22770R) |
MOFY-0722-FY16 | Mouse Anti-VEGFA Antibody (MOFY-0722-FY16) |
MOFY-0722-FY222 | Rabbit Anti-VEGFA Antibody (MOFY-0722-FY222) |
For Research Use Only | Not For Clinical Use.
Online Inquiry