AibGenesis™ Mouse Anti-hoxa9b Antibody (CBMOAB-79812FYA)


Cat: CBMOAB-79812FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-79812FYA Monoclonal Zebrafish (Danio rerio), Medaka (Oryzias latipes) WB, ELISA MO79812FYA 100 µg
Inquiry
MO-AB-00678R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00678R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Medaka (Oryzias latipes)
CloneMO79812FYA
SpecificityThis antibody binds to Zebrafish hoxa9b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish hoxa9b Antibody is a mouse antibody against hoxa9b. It can be used for hoxa9b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHomeobox protein Hox-A9b; hoxa9
UniProt IDQ9YGT5
Protein RefseqThe length of the protein is 253 amino acids long.
The sequence is show below: MSTLGTLSYYADSHIPHENDDHLAPRFSSGPVVQQQSRELTLLEYSEQEPYTFQAKSSIFGASWSPVQPTGASIAYHPYIHHPCSTGDSDGASVRPWALEPLPALPFTGLSTDTHQDIKLEPLVGSGECTTHTLLVAETDNNTTQTERKVPDDAVSNGSHDEKIPAETKLDLDPNNPSSNWLHAKSTRKKRCPYTKHQTLELEKEFLFNMYLSRDRRYEVARLLNLTERQVKIWFQNRRMKMKKCNKDRPKDI.
For Research Use Only | Not For Clinical Use.
Online Inquiry