AibGenesis™ Mouse Anti-hoxb6 Antibody (MO-AB-04336H)


Cat: MO-AB-04336H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04336H Monoclonal Frog (Xenopus laevis), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO04336C 100 µg
MO-AB-24819W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24819W 100 µg
MO-AB-26351H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26351C 100 µg
MO-AB-56920W Monoclonal Marmoset WB, ELISA MO56920W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO04336C
SpecificityThis antibody binds to Frog hoxb6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. (From NCBI)
Product OverviewThis product is a mouse antibody against hoxb6. It can be used for hoxb6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHoxb6 protein; hoxb6
UniProt IDQ05AW4
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: MSSYFVNSTFPVTLPGGQEPFLGQIPLYSSGYADPLRHYSASYGATGVQDKSYAPGPYFQQASGAYSRTAACDYGAAGFYRDKEVSCALSSLEEQSQYNQEQRKADCAHNKLVYEEQDEAKCATPVYPWMQRMNSCNSSMFGPSGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHSLCLTERQIKIWFQNRRMKWKKESKLLNSSVQSAGEDEEKPTE.
For Research Use Only | Not For Clinical Use.
Online Inquiry