AibGenesis™ Mouse Anti-HPCAL1 Antibody (CBMOAB-44782FYA)
Cat: CBMOAB-44782FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44782FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Primate, Rhesus Macaque, Sheep (Ovis aries), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset | WB, ELISA | MO44782FYA | 100 µg | ||
| MO-AB-13777R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13777R | 100 µg | ||
| MO-AB-15669Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15669Y | 100 µg | ||
| MO-AB-17845W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17845W | 100 µg | ||
| MO-AB-26367H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26367C | 100 µg | ||
| MO-AB-56933W | Monoclonal | Marmoset | WB, ELISA | MO56933W | 100 µg | ||
| MO-DKB-03241W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Rhesus Macaque, Sheep (Ovis aries), Frog (Xenopus), Zebrafish (Danio rerio) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Primate, Rhesus Macaque, Sheep (Ovis aries), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset |
| Clone | MO44782FYA |
| Specificity | This antibody binds to Rhesus HPCAL1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. Several alternatively spliced transcript variants encoding the same protein have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus HPCAL1 Antibody is a mouse antibody against HPCAL1. It can be used for HPCAL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Neuron-specific calcium-binding protein hippocalcin; HPCAL1 |
| UniProt ID | H9EZT5 |
| Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry