AibGenesis™ Mouse Anti-HPS6 Antibody (CBMOAB-44802FYA)


Cat: CBMOAB-44802FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44802FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Human (Homo sapiens), Marmoset, Pig (Sus scrofa) WB, ELISA MO44802FYA 100 µg
MO-AB-13793R Monoclonal Cattle (Bos taurus) WB, ELISA MO13793R 100 µg
MO-AB-19434W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19434W 100 µg
MO-AB-26381R Monoclonal Pig (Sus scrofa) WB, ELISA MO26381R 100 µg
MO-AB-37433W Monoclonal Goat (Capra hircus) WB, ELISA MO37433W 100 µg
MO-AB-56947W Monoclonal Marmoset WB, ELISA MO56947W 100 µg
MO-DKB-01543W Polyclonal Human (Homo sapiens), Rhesus (Macaca mulatta) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Human (Homo sapiens), Marmoset, Pig (Sus scrofa)
CloneMO44802FYA
SpecificityThis antibody binds to Rhesus HPS6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HPS6 Antibody is a mouse antibody against HPS6. It can be used for HPS6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHermansky-Pudlak syndrome 6 protein; HPS6
UniProt IDH9F3Y4
Protein RefseqThe length of the protein is 642 amino acids long.
The sequence is show below: LRGRLVWCEERQAGSEGPLGPPATAFSHCVCVRTLEPSGEASTSLGRTHVLLHHCPAFGLLASCRHLFLVPTATTWPGVAHVLLIWSPGKGKVMVAAPRLGLSYSKSLNPGRGDTWDFRTLLRGLPGLLSLREPLAVHTWAPTPHGLLLLDFGGTVSLVQSHGGTRAVGILQEAPVGSRGSAALGTFQGTLACVLGSTLELLDMGSGQLLERKVLSTDRVHLLEPPAPGMEDEEELETRGSLRLLSALGLFCVGWEAPQGVELPSAKDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSTLLTMLRTELRDYRGLEQLKAQLVAGDDEEAGWTELAEQEVARLLRTELIGDQLAQLNTVFQALPTAAWGATLRALQLQTDGNGKLRSQAPPDVWKKVLGGITAVKEPPNGILPPFELLCQCLCRLEPRWLPPFVELAQQQGGPGWGAGGPGLPLYRRALAVLGEEGTRPEALELELLLSRGRPKAVLQAVGQLVQKEQWDRALDAGLALGPSSPLLRSEIFKLLLAEFAQHRRLDAHLPLLCRLCPPELAPAELLLLLRTYLPDEVGPPTPFPEPGAEPPLTVGLLKALLEQTGTQGWPSGPVLSPYEDILWDPSTPPPTPPRDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry