AibGenesis™ Mouse Anti-Hrk Antibody (MO-AB-26376H)


Cat: MO-AB-26376H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-26376H Monoclonal Rat (Rattus norvegicus), Marmoset WB, ELISA MO26376C 100 µg
Inquiry
MO-AB-56958W Monoclonal Marmoset WB, ELISA MO56958W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Marmoset
CloneMO26376C
SpecificityThis antibody binds to Rat Hrk.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the BCL-2 protein family. Members of this family are involved in activating or inhibiting apoptosis. The encoded protein localizes to intracellular membranes. This protein promotes apoptosis by interacting with the apoptotic inhibitors BCL-2 and BCL-X(L) via its BH3 domain. Alternate splicing results in multiple transcript variants. (From NCBI)
Product OverviewThis product is a mouse antibody against Hrk. It can be used for Hrk detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActivator of apoptosis harakiri; BH3-interacting domain-containing protein 3; Neuronal death protein DP5; Hrk
UniProt IDP62817
Protein RefseqThe length of the protein is 92 amino acids long.
The sequence is show below: MCPCPRHRGRGPPAVCGCGDARPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCAAAQVAALAAWLLGRRSA.
For Research Use Only | Not For Clinical Use.
Online Inquiry