AibGenesis™ Mouse Anti-HS1BP3 Antibody (CBMOAB-44823FYA)


Cat: CBMOAB-44823FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44823FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO44823FYA 100 µg
MO-AB-13810R Monoclonal Cattle (Bos taurus) WB, ELISA MO13810R 100 µg
MO-AB-22331W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22331W 100 µg
MO-AB-56962W Monoclonal Marmoset WB, ELISA MO56962W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO44823FYA
SpecificityThis antibody binds to Rhesus HS1BP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation. (From NCBI)
Product OverviewMouse Anti-Rhesus HS1BP3 Antibody is a mouse antibody against HS1BP3. It can be used for HS1BP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHCLS1-binding protein 3; HS1BP3
UniProt IDI2CXH4
Protein RefseqThe length of the protein is 392 amino acids long.
The sequence is show below: MHSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEQQDQVAEEGPPIQGLKGEDAEESLEEEEALDPLGIMRSKKPKKHPKVAMKAKPSPRLTIFDEEVDPDQGLFGPGRKQFPQGPSEDVSSMDPLKLFDDPDLGGAVPLGDSLLLPAACESGGPTPRLGHRDASKELFRVEEDLDQILNLGAEPKPKPQPKPKPPVAAKPAIPRKPAVPRKAGLAEAVAGQQKPQEQIQAMDEMDILQYIRDHDTPAQAAPSLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry