AibGenesis™ Mouse Anti-HS6ST3 Antibody (CBMOAB-44838FYA)


Cat: CBMOAB-44838FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44838FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO44838FYA 100 µg
CBMOAB-79982FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79982FYA 100 µg
MO-AB-56977W Monoclonal Marmoset WB, ELISA MO56977W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO44838FYA
SpecificityThis antibody binds to Rhesus HS6ST3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HS6ST3 Antibody is a mouse antibody against HS6ST3. It can be used for HS6ST3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative: heparan-sulfate 6-O-sulfotransferase 3-like; HS6ST3
UniProt IDH9FAP5
Protein RefseqThe length of the protein is 267 amino acids long.
The sequence is show below: SCGLHADWTELTNCVPAIMEKKDCPRNHSHTRNFYYITMLRDPVSRYLSEWKHVQRGATWKTSLHMCDGRSPTPDELPTCYPGDDWSGVSLREFMDCSYNLANNRQVRMLADLSLVGCYNLTFMNESERNTILLQSAKNNLKNMAFFGLTEFQRKTQFLFERTFNLKFISPFTQFNITRASNVEINEGARQRIEELNFLDMQLYEYAKDLFQQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW.
For Research Use Only | Not For Clinical Use.
Online Inquiry