AibGenesis™ Mouse Anti-IAA12 Antibody (CBMOAB-23254FYB)


Cat: CBMOAB-23254FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-23254FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula) WB, ELISA MO23254FYB 100 µg
CBMOAB-34871FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO34871FC 100 µg
MO-AB-00245W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00245W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula)
CloneMO23254FYB
SpecificityThis antibody binds to Rice IAA12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice IAA12 Antibody is a mouse antibody against IAA12. It can be used for IAA12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAuxin-responsive protein IAA12; Indoleacetic acid-induced protein 12; IAA12; Os03g0633800 LOC_Os03g43410
UniProt IDQ75GK1
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: MEAAVGYAADSLIKATELRLGLPGTADDLPSTPRGKKRAAAAEDNNANAAAADDDEHDAVEAAPPVAKAQVVGWPPVRSYRKSCFQQQSAAASKSKAAVSSCNNKDEPITKNAAPAPAASSAAAANGGSLVKVSMDGAPYLRKIDLRMYKGYRELREALEAMFVCFSGAADGANPSEFAITYQDKDGDLMLVGDVPFDMFTSTCKKLRIMKRSEATGLGSPRQMKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry