AibGenesis™ Mouse Anti-IAA2 Antibody (CBMOAB-23262FYB)


Cat: CBMOAB-23262FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-23262FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Tomato (Lycopersicon esculentum) WB, ELISA MO23262FYB 100 µg
CBMOAB-34945FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO34945FC 100 µg
MO-AB-00587H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00587C 100 µg
MO-AB-34661H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34661C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Tomato (Lycopersicon esculentum)
CloneMO23262FYB
SpecificityThis antibody binds to Rice IAA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice IAA2 Antibody is a mouse antibody against IAA2. It can be used for IAA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAuxin-responsive protein IAA2; Indoleacetic acid-induced protein 2; IAA2; Os01g0190300 LOC_Os01g09450
UniProt IDQ9LG86
Protein RefseqThe length of the protein is 238 amino acids long.
The sequence is show below: MAWRRGFGREEEDAAAAGESGLELCLGLPAYFSSSSSSKPSEGSTAAPAFALRSNGTNASKPSGAAAAAPVVGWPPVRSFRRNLASSSSSSSKQAPPPPSSSPQNGDKASKDGGAEKGMFVKINMDGVPIGRKVDLAAYGGYAQLSAAVDKLFRGLLAAQSAAADGEADAAAAGEMVGGGEYTLVYEDDEGDRMLVGDVPWQMFIATAKRLRVLKSSDLPPPSLMRAAGSRKRAAADS.
For Research Use Only | Not For Clinical Use.
Online Inquiry