AibGenesis™ Mouse Anti-Icln Antibody (CBMOAB-20900FYA)


Cat: CBMOAB-20900FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-20900FYA Monoclonal Fruit fly (Drosophila melanogaster), Frog (Xenopus laevis) WB, ELISA MO20900FYA 100 µg
Inquiry
MO-AB-04428H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04428C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Frog (Xenopus laevis)
CloneMO20900FYA
SpecificityThis antibody binds to fruit fly Icln.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol; Cytoskeleton; Other locations; Plasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionChaperone that regulates the assembly of spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Icln Antibody is a mouse antibody against Icln. It can be used for Icln detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMethylosome subunit pICln; icln
UniProt IDA1ZAW5
Protein RefseqThe length of the protein is 215 amino acids long.
The sequence is show below: MVLIMRVSPPEHGLLYTANNIKLKLGDKVVGEGTVYIAQNTLSWQPTELAEGISIEWKQVSLHGISSNPRKCIYFMLDHKVEWNGVYGDPPQQAVNGRNGGGSEAEVDEGNGSDEHDEDDNFEDAVDEQFGEVTECWLMPEDIHTVDTMYSAMTTCQALHPDSANSDSEDSDPMQDAGGLEDEAMEEDDALTLGRNGVQNLSLDDDEERFEDADE.
For Research Use Only | Not For Clinical Use.
Online Inquiry