AibGenesis™ Mouse Anti-IDH3B Antibody (CBMOAB-45028FYA)
Cat: CBMOAB-45028FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-45028FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) | WB, ELISA | MO45028FYA | 100 µg | ||
| CBMOAB-60285FYC | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO60285FYC | 100 µg | ||
| CBMOAB-80253FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO80253FYA | 100 µg | ||
| MO-AB-02714W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02714W | 100 µg | ||
| MO-AB-07800W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07800W | 100 µg | ||
| MO-AB-08437Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08437Y | 100 µg | ||
| MO-AB-10776W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10776W | 100 µg | ||
| MO-AB-13946R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13946R | 100 µg | ||
| MO-AB-26470R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26470R | 100 µg | ||
| MO-AB-31219W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31219W | 100 µg | ||
| MO-AB-41848W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41848W | 100 µg | ||
| MO-AB-45090W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45090W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) |
| Clone | MO45028FYA |
| Specificity | This antibody binds to Rhesus IDH3B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus IDH3B Antibody is a mouse antibody against IDH3B. It can be used for IDH3B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | IDH3B |
| UniProt ID | F6URC2 |
| Protein Refseq | The length of the protein is 175 amino acids long. The sequence is show below: MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYDSAQQSRPGDHSRADRRGVQLSGT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry