AibGenesis™ Mouse Anti-ier2 Antibody (CBMOAB-80268FYA)


Cat: CBMOAB-80268FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-80268FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO80268FYA 100 µg
MO-AB-04438H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04438C 100 µg
MO-AB-13953R Monoclonal Cattle (Bos taurus) WB, ELISA MO13953R 100 µg
MO-AB-17007W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17007W 100 µg
MO-AB-26417H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26417C 100 µg
MO-AB-57118W Monoclonal Marmoset WB, ELISA MO57118W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO80268FYA
SpecificityThis antibody binds to Zebrafish ier2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ier2 Antibody is a mouse antibody against ier2. It can be used for ier2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesImmediate early response 2; ier
UniProt IDB7SXM5
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MDVTAEAKQIMVQALGKMYSSRSQRGGLRLHRSLLLTLVMKSARDIYHSARLMSEKSGQSVTEECTSHTQEPMDTSSSTATPLRETSGQSSEDGQRSGLEGHPHPLNPAADKENCGPSRPDRHSRKRRSKTATDSDFIPCKKAKLECAEVRGVLQNSSANCGRALDSLSLVPMPRTIVTF.
For Research Use Only | Not For Clinical Use.
Online Inquiry